Protein Info for GFF327 in Pseudomonas sp. DMC3

Annotation: CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydr ase reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 3 to 71 (69 residues), 42.5 bits, E=5.2e-15
• PF00175: NAD_binding_1
  • amino acids 197 to 295 (99 residues), 55.7 bits, E=7.2e-19

Best Hits

KEGG orthology group: K00523, CDP-4-dehydro-6-deoxyglucose reductase [EC: 1.17.1.1] (inferred from 95% identity to pfo:Pfl01_5453)

Predicted SEED Role

"2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases / CDP-6-deoxy-delta-3,4-glucoseen reductase-like" in subsystem Central meta-cleavage pathway of aromatic compound degradation

MetaCyc Pathways

• CDP-4-dehydro-3,6-dideoxy-D-glucose biosynthesis (3/3 steps found)
• superpathway of CDP-glucose-derived O-antigen building blocks biosynthesis (3/8 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.1

Protein Sequence (322 amino acids)

>GFF327 CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydr ase reductase (Pseudomonas sp. DMC3)
MRVTLQPSGAVLEIQPGERILDGARRLGYDCPQSCRNGNCHVCAALLVEGRVEQAGEVHD
HGEFYTCIAAPLEDCVLLWDGVLALGELPVRSLSCQVIECREVGGDTWRVRLRAPAGKPP
RYHAGQYLMIERENGEKSAFSMASAPHGGRDLEIHVLARETSALSLIEQLQRNPMVRVEL
PFGDTHLAELPDGPLVLIAAGTGMGQIHSLIEHCRAEGFKHPVHLYWGVRRPEDFYQIEH
WDEWLKLPNLFLHKVVSDQCGWEGRCGMLHEAVCEDFPDLKPLHVYASGSPAMVYGTLDA
LVEAGMDAHQMRADVFAYAPRS