Protein Info for GFF327 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Surface antigen gene

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 46 to 73 (28 residues), 30 bits, see alignment (E = 2e-11) PF10282: Lactonase" amino acids 168 to 340 (173 residues), 27.6 bits, see alignment E=8.9e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>GFF327 Surface antigen gene (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTTQRRDILKYTLAAAAASALPAAHAQAPSGASAGAAATGIDPRDRVFITNEDSNTLVVI
DPKTNTVESTINLTSFDEDPRPPFRYVTAGVAPTHAAMIHKPLYHGCIDAHGAVPSPDGR
LLATSGRGSSNIYLIDAEQRRVIGNTPNPASGPTTNPERLSSGLLLGREPHEPTFTRNGR
ELWVTLRGEDRIAIVGVDRAVRQLKGADSPGSSAVRQYLPTLSGPAQVWFNREGTLAFVA
SQKVSKIDVFRVNPGADGHSQPQRLTTLDISAQDKPGFTPFMKTTPDGAEVWFSHKLADA
VSCRSTQGGFDLIDTVPLGMGARPNHVEFVRNARGSVVYASLARIDDGGPGGVASSPIAI
IDRSAPGGQRKVVGTFSSRGRESHGLWTNPENTLLYVAHEQDELPGTPNAGQTVCSAFDV
SDPLRPTFIAQIPLGNLTLPSGALRNKKSINLVYVRVGEKGQTA