Protein Info for GFF3267 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: HupE-UreJ family metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 113 to 129 (17 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details PF04955: HupE_UreJ" amino acids 10 to 182 (173 residues), 170.4 bits, see alignment E=1.4e-54

Best Hits

Swiss-Prot: 39% identical to HUPE_RHILV: Protein HupE (hupE) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K03192, urease accessory protein (inferred from 58% identity to vap:Vapar_4241)

Predicted SEED Role

"HupE-UreJ family metal transporter" in subsystem Transport of Nickel and Cobalt or Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>GFF3267 HupE-UreJ family metal transporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKLKHLLTLSLAALSFSAFAHVGDAHDNGGLLTGFLHPVTGLDHLAAMLAVGVWSAMTTK
RLWVAPLSFAALLLAGALMAQAGVAFPAIEPMIAASMLVVGLLLAAQVKLPEAAGAVLVG
AFALFHGAAHGQELAAGAALAGMVLGTAALHAAGIAIGLGFQRAHRWLPRLAGGVVALMG
LNMGWSLLAG