Protein Info for GFF3267 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Invasion gene E protein (Pathogenicity island encoded protein: homologous to ipgE of Shigella)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 PF07824: Chaperone_III" amino acids 3 to 113 (111 residues), 184.1 bits, see alignment E=3.5e-59

Best Hits

Swiss-Prot: 100% identical to SIGE_SALTY: Chaperone protein SigE (sigE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 98% identity to sed:SeD_A1166)

Predicted SEED Role

"Invasion gene E protein (Pathogenicity island encoded protein: homologous to ipgE of Shigella)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (113 amino acids)

>GFF3267 Invasion gene E protein (Pathogenicity island encoded protein: homologous to ipgE of Shigella) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MESLLNRLYDALGLDAPEDEPLLIIDDGIQVYFNESDHTLEMCCPFMPLPDDILTLQHFL
RLNYTSAVTIGADADNTALVALYRLPQTSTEEEALTGFELFISNVKQLKEHYA