Protein Info for GFF3264 in Variovorax sp. SCN45

Annotation: Methionine biosynthesis protein MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 TIGR02081: methionine biosynthesis protein MetW" amino acids 7 to 191 (185 residues), 236.5 bits, see alignment E=9.3e-75 PF07021: MetW" amino acids 7 to 189 (183 residues), 196.7 bits, see alignment E=9.6e-62 PF13489: Methyltransf_23" amino acids 8 to 103 (96 residues), 42.7 bits, see alignment E=1.6e-14 PF13847: Methyltransf_31" amino acids 17 to 111 (95 residues), 28.3 bits, see alignment E=4e-10 PF13649: Methyltransf_25" amino acids 20 to 104 (85 residues), 38.9 bits, see alignment E=3.4e-13 PF08241: Methyltransf_11" amino acids 21 to 106 (86 residues), 46.6 bits, see alignment E=1.3e-15 PF08242: Methyltransf_12" amino acids 21 to 104 (84 residues), 32.2 bits, see alignment E=4.4e-11

Best Hits

KEGG orthology group: None (inferred from 99% identity to vpe:Varpa_6008)

Predicted SEED Role

"Methionine biosynthesis protein MetW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>GFF3264 Methionine biosynthesis protein MetW (Variovorax sp. SCN45)
MSDLEHQRLIAQLVPQGSRVLDLGCGDGALLDLLQRERGCTGYGVEIADGNVLQCVRRGV
DVIQLNLDEGLSMFDDASFDVVLQIDTLQHLRNAEVMLRETARVGRIGIVAFPNFAHWPN
RLSVARGRMPVTRRLPYQWYDTPNIRVGTFKDFEVLAGKNNLRVLDAFGLQDGRDVRWLP
NARASTAVFKFERGGG