Protein Info for GFF3263 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR03424: urea carboxylase-associated protein 1" amino acids 15 to 210 (196 residues), 328.8 bits, see alignment E=5.2e-103 PF09347: DUF1989" amino acids 21 to 185 (165 residues), 231.9 bits, see alignment E=1.8e-73

Best Hits

Swiss-Prot: 33% identical to YCGI_BACSU: Uncharacterized protein YcgI (ycgI) from Bacillus subtilis (strain 168)

KEGG orthology group: K09967, hypothetical protein (inferred from 91% identity to xau:Xaut_1223)

Predicted SEED Role

"Urea carboxylase-related aminomethyltransferase (EC 2.1.2.10)" in subsystem Urea decomposition (EC 2.1.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.10

Use Curated BLAST to search for 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>GFF3263 hypothetical protein (Xanthobacter sp. DMC5)
MTQFFASPVRDASSALRDYFVPANAPFSCLVKAGESVRIVDLEGQQAVDTLFYKADDFAE
RYSSQDTLRVQGSAYVSTGTKLISTEGHVMLTVTADTCGRHDTSAGACSCEANTVRFGHQ
VKYLHACRENFVIEVAKHGMTKRDIVPNINFFMNVPVEPTGELAIVDGISGPGDYVELRA
EMDVLLVISNCPQINNPCNGFNPTPIQVLVFGAED