Protein Info for GFF3262 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: tRNA 2-thiouridine synthesizing protein E (EC 2.8.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03342: sulfur relay protein, TusE/DsrC/DsvC family
  • amino acids 4 to 109 (106 residues), 166 bits, E=1.5e-53
• PF04358: DsrC
  • amino acids 4 to 109 (106 residues), 154.5 bits, E=6e-50

Best Hits

Swiss-Prot: 100% identical to TUSE_SALTI: Sulfurtransferase TusE (tusE) from Salmonella typhi

KEGG orthology group: K11179, tRNA 2-thiouridine synthesizing protein E [EC: 2.8.1.-] (inferred from 99% identity to ses:SARI_01928)

MetaCyc: 91% identical to sulfur transfer protein TusE (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 2-thiouridine synthesizing protein E (EC 2.8.1.-)" in subsystem Sulfate reduction-associated complexes (EC 2.8.1.-)

MetaCyc Pathways

• tRNA-uridine 2-thiolation and selenation (bacteria) (6/11 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Protein Sequence (109 amino acids)

>GFF3262 tRNA 2-thiouridine synthesizing protein E (EC 2.8.1.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLIFEGKEISTDSEGYLKETTQWSEALAVAIAANEGIELSAEHWEVVRFVREFYLEFNTS
PAIRMLVKAMANKFGEEKGNSRYLYRLFPKGPAKQATKIAGLPKPVKCI