Protein Info for GFF3261 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 59 to 83 (25 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 206 to 223 (18 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 359 to 382 (24 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>GFF3261 hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
LFILSARLFSPADNASFIYAITLPQLLIQLGTLGWLNLIRKEISRRSELPPALLKGFVIR
SLQIPIAAIFLTSCCVAMAPVFMGEHMTTIYSVAALVTMVYAVNALMREYLVALGTPAFG
IFAAESVPFLFASCALWLIRPAHADAAILLFLLGLSLACVLQIPAVIQALRPYLKPGKPV
FQTREWLRTGGHSLLGFGGRAILDRLDTLTLATLAPAVEFAYYNSAQRITGLLMLAPVVL
IPVFSPHLSKAFSSNNTSLLRREMVTQTFVVCAGVLPLAALMLIAPANLMSQLYGEDYRA
SAHVFSLIAFSQTMFALSLPWSNLTLMCDREKLYGYAHMAALLLILPIALGLVQDWRAMA
VAISVLIANAFLFFVFFSVGLYDLMLRAEKVA