Protein Info for GFF326 in Variovorax sp. SCN45

Annotation: Polysaccharide deacetylase, caspase activity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 925 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF01522: Polysacc_deac_1" amino acids 252 to 382 (131 residues), 93.4 bits, see alignment E=5.4e-30 PF00656: Peptidase_C14" amino acids 480 to 677 (198 residues), 76.6 bits, see alignment E=1.2e-24 PF13432: TPR_16" amino acids 803 to 863 (61 residues), 36.2 bits, see alignment 3.3e-12 amino acids 855 to 898 (44 residues), 23.4 bits, see alignment 3.3e-08 PF13424: TPR_12" amino acids 832 to 890 (59 residues), 31.2 bits, see alignment 1e-10 PF14559: TPR_19" amino acids 843 to 909 (67 residues), 33.9 bits, see alignment 1.6e-11 PF13181: TPR_8" amino acids 868 to 899 (32 residues), 17.7 bits, see alignment (E = 1.6e-06)

Best Hits

KEGG orthology group: None (inferred from 54% identity to xcb:XC_4329)

Predicted SEED Role

"Polysaccharide deacetylase, caspase activity"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (925 amino acids)

>GFF326 Polysaccharide deacetylase, caspase activity (Variovorax sp. SCN45)
MAMAALAVAGLAACQPESAGTAATPAAAAPAAVAPPPAPAVPAGIPAALQERADALLAAH
RQMIVLMTGERTLDAAEKRAVGAVGQMLFHDMQERQQALIAQAGEMTDPATVPALNALLD
RIESEPSWFDADRLAFKEFLSELSTRYAQAQSLPGLKLGRRASEDLAVLAEIEQAYDREL
KDVFGRFAQRGIEPQREKWSDYVAKLQGLYSREKILKDFGSIVPYTQATQPAGTNAKEKE
GADTREIFGTSLPPKTVVLTFDDGPHARHTDEILEILKRYDAPAIFFELGRNLGKLDAQG
KAQLGANGAVAKRVLAAGHVLANHSFSHGMMAKMSDDTVRTEASETEALLDATGRPQSTL
FRFPYGARNEDKLSTVEALKLRSMLWTVDSMDWADPVPKSIADRVLAEVDKAKRGVILFH
DIQGRTVQALPTVLDQLVADGYRFATWRDGKFVVSASKRATPGDSIAAAGAGDTLYRESH
ALIIGIDKYAKWPGLHHAVPDARSMEQLLVTRFGFKPENVTSLYDGEATRANILRALNDK
LADAKRVKRDDRVLVFFAGHGSTRKLASGRDVGYIIPVDAALDDLASDAISMPQLQEVAE
ALSAKHVLFLVDACYSGLGLTRGGAPQGSKNFLTDNARRIGRQMLTAGGADQQVADDGPG
GHSVFTWTMLQALSGKADLNGDGVITGTELAAYVAPAVSAIARQTPAFGSLPGSEGGEFV
FELPTDREGLSGDIVQLDAAASQVNKRIDEANEQAVHTAAAAPKAGPAAIEVVVKNLEGA
DAKLTMPAAAPVSPRVAAQRANDRGLQLYRERRYDEAEAAFTEALKLQPRFALAANNLGF
VYFKRGKPVEAARWFEQAIDMDGSRALAYLNLGDAYLQAGNDAKALAAYTTFVGLAPKHA
RVASLQAWIATPDAAHRPQLPPTNS