Protein Info for GFF326 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: PTS system, mannose-specific IIC component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 49 to 66 (18 residues), see Phobius details amino acids 94 to 111 (18 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 211 to 239 (29 residues), see Phobius details PF03609: EII-Sor" amino acids 6 to 237 (232 residues), 252.4 bits, see alignment E=2e-79

Best Hits

KEGG orthology group: K02795, PTS system, mannose-specific IIC component (inferred from 98% identity to cko:CKO_05130)

MetaCyc: 100% identical to D-glucosaminate PTS permease components EIIC (Salmonella enterica enterica serovar Typhimurium str. 14028S)
RXN-14729 [EC: 2.7.1.203]

Predicted SEED Role

"PTS system, mannose-specific IIC component"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.203

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>GFF326 PTS system, mannose-specific IIC component (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDTLLFASLMGLYYWFARLRLGYTFSAMLLQPVVIAVFVGLLLGNMQTAMIIGAGMQLVY
LGVTSTPGGNVPSDPALAACISIPIAVKAGMDPNLAIALAIPFGVIGVFLDQLRRTLNAA
WVHMADKHAETANMAGIMRCAFLYPALLGLVLRFPVVFAANYFGQDVVESFLKLMPHWLT
HSFEIMGGILPALGFAITIMVIGKKSLLPWFIGGFFAVLYLKVDIMAMAIFGTCVAFLIK
GLAKNEGAA