Protein Info for PS417_16680 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 78 to 102 (25 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details amino acids 269 to 302 (34 residues), see Phobius details amino acids 338 to 347 (10 residues), see Phobius details amino acids 351 to 370 (20 residues), see Phobius details PF07690: MFS_1" amino acids 239 to 372 (134 residues), 40.7 bits, see alignment E=7.3e-15

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU3839)

Predicted SEED Role

"probable MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UMP5 at UniProt or InterPro

Protein Sequence (376 amino acids)

>PS417_16680 MFS transporter (Pseudomonas simiae WCS417)
MSSLALRTADTHSRRAALTLALCLPSDVLLYLLLPMESQAFGITLAQAGVLLAANRLVRI
FGYRHVLNFYARHGDRLTCMIAAGAASLCAVGNSLLSGFAALLCLRLVWGLCFAALNLST
QVLATSEPAGAARRAGRSRALIALGPMLALPLGGWLTLMAGPRPIFLILAGCCLVGLWMA
RGLPRAGHDLHGTPGRRFKWPDSVAMWSFIEGVALDGLFIFGLSIQAQKLLGGDAVLIAG
GLMVLRYVSEMLLSPLGGRAAQRFGATSMLLLFSFLSALALIAFGSYWVIVGAAAVLVLR
ALQLPLVTTLVAERNPGSMRVSALASNAVWRDIGAGLGPLLAGLLLPIASAPWVFGLAGA
AIAVSAVFCWRTKMPN