Protein Info for GFF325 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: PTS system, gluconate-specific IIB component (EC 2.7.1.69)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF03830: PTSIIB_sorb" amino acids 4 to 150 (147 residues), 151.2 bits, see alignment E=1.4e-48

Best Hits

Swiss-Prot: 30% identical to PTFB_BACSU: PTS system fructose-specific EIIB component (levE) from Bacillus subtilis (strain 168)

KEGG orthology group: K02794, PTS system, mannose-specific IIB component [EC: 2.7.1.69] (inferred from 99% identity to sec:SC3691)

MetaCyc: 99% identical to D-glucosaminate PTS permease components EIIB (Salmonella enterica enterica serovar Typhimurium str. 14028S)
RXN-14729 [EC: 2.7.1.203]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.203 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>GFF325 PTS system, gluconate-specific IIB component (EC 2.7.1.69) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MANIVLCRIDSRLIHGQVVTKWVGQSQANRIAVVSDELDADPFMKNIYLMAAPPNIKVDC
FGNQSFAAAWKENQLGDGNVLVLFPSLAAVQDAIQLGFDVTRIQVGGLGGGPNRKAVFQN
ITLDEKDVGILNDLKNRGVQVFFQTIPEDKPQPLDDILKKF