Protein Info for GFF3248 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sulfate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 240 to 264 (25 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details amino acids 371 to 398 (28 residues), see Phobius details PF00916: Sulfate_transp" amino acids 1 to 375 (375 residues), 329.3 bits, see alignment E=2.8e-102 TIGR00815: sulfate permease" amino acids 1 to 526 (526 residues), 405.2 bits, see alignment E=2.1e-125 PF01740: STAS" amino acids 428 to 534 (107 residues), 57.2 bits, see alignment E=1.3e-19

Best Hits

KEGG orthology group: None (inferred from 63% identity to pgv:SL003B_4259)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (544 amino acids)

>GFF3248 Sulfate permease (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLIPQSLAYALLAGLPPQAGLYASMLPLLAYGVLGSSRMLAVGPAAVTSLMTAAAVGQVA
AVGSVAYGEAALLLALLSGLMLTAMGLLRLGFLANYLSHPVISGFISASGVLIAVGQVKH
LLGIAASGDTLPELLPALWRGLPHANGHALALGLAVLAFLWWARKRLKSLLLRLGIGPRL
ADALAKAGPVATIAATTVAVWHWDLATSHGVRVVGVVPQGLPPFTPPAWSPALWTQLAEL
AAPALLLSVVGFVESISVGQTLAAKRRQRVEPDQELVALGASNVAAAFSGGLPVTGGFSR
SVVNFDAGAQTPAAGIYTAAGIAVATLLFTPLLHHLPQATLAATIIVAVLALVDLDMLRR
TWRYSRFDFSVVSATLVATLLAGVEVGLVAGVGLALALHLYRSGRPHIAVVGQVPGTEHF
RNVLRHRVRTSPHVLGLRIDESLYFANARYLEDRINGAVAEAPGELRHVVLQCSAINDID
ASALESLEAIEARLREADIQLHLSEVKGPMMDRLSRTPFLAHIGGRIHLTHYQAIAALAP
ESLV