Protein Info for GFF3244 in Xanthobacter sp. DMC5

Annotation: RNA polymerase sigma factor RpoD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 PF03979: Sigma70_r1_1" amino acids 27 to 101 (75 residues), 78.8 bits, see alignment E=7e-26 PF00140: Sigma70_r1_2" amino acids 129 to 162 (34 residues), 50.3 bits, see alignment (E = 5.5e-17) PF04546: Sigma70_ner" amino acids 171 to 399 (229 residues), 139.3 bits, see alignment E=5.2e-44 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 428 to 653 (226 residues), 129 bits, see alignment E=1.4e-41 TIGR02393: RNA polymerase sigma factor RpoD" amino acids 428 to 664 (237 residues), 399.9 bits, see alignment E=3.8e-124 PF04542: Sigma70_r2" amino acids 432 to 502 (71 residues), 82.7 bits, see alignment E=3.7e-27 PF04539: Sigma70_r3" amino acids 511 to 586 (76 residues), 104.4 bits, see alignment E=8.4e-34 PF04545: Sigma70_r4" amino acids 600 to 653 (54 residues), 64.2 bits, see alignment 1.9e-21

Best Hits

Swiss-Prot: 75% identical to RPOD_RHIEC: RNA polymerase sigma factor RpoD (rpoD) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K03086, RNA polymerase primary sigma factor (inferred from 97% identity to xau:Xaut_1238)

Predicted SEED Role

"RNA polymerase sigma factor RpoD" in subsystem Flagellum or Macromolecular synthesis operon or Transcription factors cyanobacterial RpoD-like sigma factors or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (666 amino acids)

>GFF3244 RNA polymerase sigma factor RpoD (Xanthobacter sp. DMC5)
MAKQSSEATEAPEKETDAPDGPLLDLSDAAVRKMIKNAKRRGYVTYEQLNEVMPSEEVTS
EQIEDTLAMLNDMGINVIEAEEAEAEEGGEEAETADEPEEAEGGELTEAAPRAVARAETK
SEPAERTDDPVRMYLREMGSVELLSREGEIAIAKRIEAGREAMIAGLCESPLTFQAIIIW
RDELTEGRVLLRDIIDLEATYAGPEGKNPPAALGEEAALAPEAGEDGLLGDGAGPEGEED
DMENSMSLAAMEAEIKPKVVETFDRIHSSYTKLRRLQDQNVESKLKNETLSPAQERKAKK
LKEELVGDVKSLSLNQARIDALVEQLYEINKRLVGYEGRLLRLADSYGVSRDDFLKNYMG
AELDPKWVLRISKLGTRGWKGFVAHEKDTIHEIRGDIHALATETGLEIAEFRKIVQMVQK
GEKEARQAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKF
STYATWWIRQAITRSIADQARTIRIPVHMIETINKIVRTSRQMLHEIGREPTPEELAEKL
GMPLEKVRKVLKIAKEPISLETPIGDEEDSHLGDFIEDKNAILPIDAAIQSNLRETTTRV
LASLTPREERVLRMRFGIGMNTDHTLEEVGQQFSVTRERIRQIEAKALRKLKHPSRSRKL
RSFLDN