Protein Info for GFF3244 in Sphingobium sp. HT1-2

Annotation: tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF00733: Asn_synthase" amino acids 13 to 87 (75 residues), 29.9 bits, see alignment E=1.2e-10 PF02540: NAD_synthase" amino acids 14 to 88 (75 residues), 22 bits, see alignment E=2.1e-08 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 15 to 357 (343 residues), 311.7 bits, see alignment E=2.8e-97 PF03054: tRNA_Me_trans" amino acids 15 to 212 (198 residues), 241.7 bits, see alignment E=1.4e-75 PF20259: tRNA_Me_trans_M" amino acids 229 to 282 (54 residues), 68.6 bits, see alignment 6.7e-23 PF20258: tRNA_Me_trans_C" amino acids 292 to 357 (66 residues), 52.6 bits, see alignment E=1.2e-17

Best Hits

Swiss-Prot: 79% identical to MNMA_SPHWW: tRNA-specific 2-thiouridylase MnmA (mnmA) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 94% identity to sch:Sphch_2381)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>GFF3244 tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13) (Sphingobium sp. HT1-2)
MQPEFQLPEPLSQRRIVVAMSGGVDSSVVAALAAKTGAEVIGVTLQLYDHGAAVGRTGSC
CAGQDIRDARAVADRIGIAHYVFDYESQFRDSVIADFADEYMAGRTPIPCVKCNMGVKFT
DLFQIARDLGADCLATGHYVRRVEGPQGAELHRAADPARDQSYFLFATTQAQLDYLRFPL
GGLPKPQVREIAAELGLSVALKPDSQDICFVPDGDYAKIVRKLRPDADEGGDIVHVDGRV
LGRHKGLIHYTVGQRKGLEIGGQAEPLYVVRLDAEGRRVIVGPKVALAVSGARLSDINWL
GRDFTGPLTAKVRSMAKPVPARLEGDRLIFDAPEYGVAPGQAAVLYAGDQVLGGGWIAAT
EAALAEVA