Protein Info for GFF3243 in Xanthobacter sp. DMC5

Annotation: DNA primase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 TIGR01391: DNA primase" amino acids 3 to 414 (412 residues), 425.2 bits, see alignment E=1.3e-131 PF01807: Zn_ribbon_DnaG" amino acids 6 to 98 (93 residues), 101.7 bits, see alignment E=4e-33 PF08275: DNAG_N" amino acids 123 to 248 (126 residues), 132.3 bits, see alignment E=2.9e-42 PF13662: Toprim_4" amino acids 259 to 323 (65 residues), 60 bits, see alignment E=5.4e-20 PF01751: Toprim" amino acids 259 to 331 (73 residues), 36.4 bits, see alignment E=1.2e-12 PF13155: Toprim_2" amino acids 262 to 348 (87 residues), 57.8 bits, see alignment E=2.8e-19

Best Hits

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 86% identity to xau:Xaut_1239)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (643 amino acids)

>GFF3243 DNA primase (Xanthobacter sp. DMC5)
MRFSPAFLDEIRARLPVSEVVGRRVKLKKQGREFAGLSPFNAEKTASFFVNDQKGFYHCF
SSGKHGDVFDFLMETEGASFGEAVERLAAMAGLSLPQETPEAAAKEQRRRTLYEVMALAA
KHFEATLQSRLGAKARGYLADREIGPATQKRFGLGYAAGERFNLKEALGKEGVSVADMVE
AGLLIAGEDIPVPYDRFRDRVMFPITDLKGRVVAFGGRALEKDVPAKYLNSPETPLFHKG
SLLYNGFSARTAAQTGARVIAVEGYVDVIAMVEAGFGGAVAPLGTALTEEQLQLLWRMSE
EPLLLFDGDKAGRRAAHRAIDLALPHLKAGRSLSFAALPEGQDPDDLIRRSGREAMEQVL
AQARPLAAELWARESENASLETPERRAALEGRLNEVVNAIGDETVRKHYRADLMGRFNAL
MAPAERARPSGRREGWSPGFTPGRGRGGKFPGKPSAPPLAPRGQEIARSALVRGPMAALP
RNEALLLFCLINHPFLLDEAGEEVSSLPFANPEADRLRRALIEAHLEGLDGEALAAHLDR
SDLDALTRRVKALANPRHDWPAYSDTAETDVRLWWHQRTALHRKAHALSRELKEAERTLG
EDPSEANFAWLRDVRERLSAIDGTEALVEGFGASSGRSAVRSL