Protein Info for GFF3240 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Rod shape determination protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF17989: ALP_N" amino acids 20 to 168 (149 residues), 96 bits, see alignment E=2.6e-31 TIGR03739: PRTRC system protein D" amino acids 20 to 338 (319 residues), 537.7 bits, see alignment E=3.8e-166 PF21522: MreB-like_C" amino acids 190 to 310 (121 residues), 67 bits, see alignment E=2.6e-22

Best Hits

KEGG orthology group: None (inferred from 93% identity to adk:Alide2_2765)

Predicted SEED Role

"Rod shape determination protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>GFF3240 Rod shape determination protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLIGMVFHFWSTLMELIVRAVDVGSGNTKFVTGVTGADIRCGSFPSVAYPSSGETPHWPA
SERRKTVCIPVGPLFYEVGPDVGLAADTFRAKQLHDEYTDSPEYMALLRGALSMMKVPHI
DLLIVGLPVALFTLKKAALEKAMVGDHQVGGGKTVTVAKAMAVAQPQGALVHYAAEHEKM
TTIGTEQSLVIDPGSRTFDWLVTRGMRLVQKQSNSINRGMSDVLRLLATEISKDIGTPYR
DYDAIDLALRTGKAPVIFQKPYDMKRHLPLAESVAQQAVSTMRQWIETPESLQNIILVGG
GAFLFKKAVKAAFPQHRIHEVKEPMFANVRGFQLAGQNYAASALASGRDRGAGEVA