Protein Info for GFF3240 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: COG0488: ATPase components of ABC transporters with duplicated ATPase domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 635 PF00005: ABC_tran" amino acids 19 to 185 (167 residues), 79.3 bits, see alignment E=3.3e-25 amino acids 336 to 469 (134 residues), 94.4 bits, see alignment E=7.2e-30 PF12848: ABC_tran_Xtn" amino acids 224 to 297 (74 residues), 45.7 bits, see alignment E=4.2e-15 PF16326: ABC_tran_CTD" amino acids 561 to 629 (69 residues), 78 bits, see alignment E=3.8e-25

Best Hits

Swiss-Prot: 94% identical to UUP_ECOLI: ABC transporter ATP-binding protein uup (uup) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to cro:ROD_10111)

Predicted SEED Role

"COG0488: ATPase components of ABC transporters with duplicated ATPase domains" in subsystem Folate Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (635 amino acids)

>GFF3240 COG0488: ATPase components of ABC transporters with duplicated ATPase domains (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSLISMHGAWLSFSDAPLLDNAELHIEDNERVCLVGRNGAGKSTLMKILNREQGLDDGRI
IYEQDLIVARLQQDPPRNIAGSVYDFVAEGIEEQAEYLKRYHEISRLVMTDPSEKNLNEM
ARVQEQLDHHNLWQLENRINEVLAQLGLDPNAALSSLSGGWLRKAALGRALVSNPRVLLL
DEPTNHLDIETIDWLEGFLKTFNGTIIFISHDRSFIRNMATRIVDLDRGKLVTYPGNYDQ
YLLEKEEALRVEELQNAEFDRKLAQEEVWIRQGIKARRTRNEGRVRALKAMRRERSERRE
VMGTAKMQVEEATRSGKIVFEMENVDYQVEGKQLVKDFSAQVQRGDKIALIGPNGCGKTT
LLKLMLGQLQADSGRIHVGTKLEVAYFDQHRAELDPEKTVMDNLAEGKQEVMVNGKPRHV
LGYLQDFLFHPKRAMTPVRALSGGERNRLLLARLFLKPSNLLILDEPTNDLDVETLELLE
ELIDGYQGTVLLVSHDRQFVDNTVTECWIFEGGGKIGRYIGGYHDARAQQEQHLATKQPM
AKKNEEVIAPKAEIVKRGSSKLSYKLQRELEQLPGQLEDLEAKLEALQAQVADAAFFSQP
HEQTQKVLADLSQAEQELEQAFERWEYLEGLKNGA