Protein Info for PS417_16580 in Pseudomonas simiae WCS417

Annotation: NADH dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 48 to 182 (135 residues), 223.3 bits, see alignment E=5.5e-71 PF01058: Oxidored_q6" amino acids 67 to 175 (109 residues), 91.2 bits, see alignment E=2.2e-30

Best Hits

Swiss-Prot: 100% identical to NUOB_PSEU2: NADH-quinone oxidoreductase subunit B (nuoB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 98% identity to pfo:Pfl01_3604)

MetaCyc: 94% identical to NADH-quinone oxidoreductase subunit B (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYM0 at UniProt or InterPro

Protein Sequence (224 amino acids)

>PS417_16580 NADH dehydrogenase (Pseudomonas simiae WCS417)
MQYNLTRIDPDAPNEQYPIGERETVSDPLEDQVHKNIYMGKLEDVLSGAVNWGRKNSLWP
YNFGLSCCYVEMTTAFTAPHDIARFGAEVIRASPRQADFMVIAGTCFIKMAPIIQRLYEQ
MLEPKWVISMGSCANSGGMYDIYSVVQGVDKFLPVDVYVPGCPPRPEAFLQGLMLLQESI
GKERRPLSWVVGDQGVYRAEMPSQKEQRREQRIQVTNLRSPDEV