Protein Info for GFF3237 in Xanthobacter sp. DMC5

Annotation: Formyl-CoA:oxalate CoA-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 TIGR03253: formyl-CoA transferase" amino acids 3 to 409 (407 residues), 581.6 bits, see alignment E=3.9e-179 PF02515: CoA_transf_3" amino acids 5 to 386 (382 residues), 339.6 bits, see alignment E=1.2e-105

Best Hits

Swiss-Prot: 62% identical to FCTA_STRAW: Formyl-CoA:oxalate CoA-transferase (frc) from Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)

KEGG orthology group: K07749, formyl-CoA transferase [EC: 2.8.3.16] (inferred from 91% identity to xau:Xaut_1246)

MetaCyc: 51% identical to formyl-CoA transferase (Escherichia coli K-12 substr. MG1655)
Formyl-CoA transferase. [EC: 2.8.3.16]

Predicted SEED Role

"Formyl-coenzyme A transferase (EC 2.8.3.16)" (EC 2.8.3.16)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.16

Use Curated BLAST to search for 2.8.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>GFF3237 Formyl-CoA:oxalate CoA-transferase (Xanthobacter sp. DMC5)
MGKALDGVRVLDMTHVQSGPSATQLLAWLGADVIKVEMPRRGDITRSQLRDKSNVDSLYF
TMLNANKKSVTLNIKTPAGQEALNRLVETCDVLVENFGPGVLDRQGFGYDQVRTRNPRLI
YASIRGFAEASGVDAKAYETIAQAMGGAMSTTGWRSGPPTASSAQIGDTGTGIHCVAGIL
AALFQRTVTGEGQKVDVAMQDCVVNLLRVKLRDQQRLDAGALAEYPGAPTGECVPRAGNC
SGGGQPGAALRCAPGGENDYCYVIIQPQGWAPLMRLVGRKDLIDDPKFASHEARAQRLDQ
CFEIIERWTARRTKFEVMEALNAIDVPCGPVLSTKDIMEDRALYDRGFLVEVPHPERGTY
VTVGSPISLSANHVPVERAPLLGEHTDEVLASVGFSDEEIAGMRAAGAV