Protein Info for PS417_16545 in Pseudomonas simiae WCS417

Annotation: DNA repair protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04356: DUF489" amino acids 6 to 198 (193 residues), 229.2 bits, see alignment E=2.4e-72

Best Hits

Swiss-Prot: 99% identical to HFLD_PSEFS: High frequency lysogenization protein HflD homolog (hflD) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K07153, high frequency lysogenization protein (inferred from 99% identity to pfs:PFLU3812)

Predicted SEED Role

"FIG002903: a protein of unknown function perhaps involved in purine metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJH7 at UniProt or InterPro

Protein Sequence (207 amino acids)

>PS417_16545 DNA repair protein (Pseudomonas simiae WCS417)
MSPTQEQLTALGGVFLSAVLVDKIAKTGQVTEAGLTCMLGSLLIRDPKDTLEVYGGDDLA
LREGYRALIGALERDPSTLQREPLRYALSMLGLERQLAKRDDMLEVIGKRLPQIQSQVEH
FGPAHENVIAACGALYQDTLSTLRQRIQVHGDMRNLQQPNNASKIRALLLAGIRSARLWR
QLGGHRWQLVISRRKLLKELYPLMRNE