Protein Info for GFF323 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transcriptional regulatory protein zraR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 932 transmembrane" amino acids 631 to 651 (21 residues), see Phobius details PF00158: Sigma54_activat" amino acids 112 to 270 (159 residues), 139.7 bits, see alignment E=2.4e-44 PF14532: Sigma54_activ_2" amino acids 135 to 240 (106 residues), 30.1 bits, see alignment E=1.6e-10 PF07728: AAA_5" amino acids 136 to 244 (109 residues), 32.3 bits, see alignment E=2.8e-11 PF00004: AAA" amino acids 137 to 278 (142 residues), 23.3 bits, see alignment E=2.2e-08 PF00874: PRD" amino acids 850 to 930 (81 residues), 31.5 bits, see alignment E=5.5e-11

Best Hits

Swiss-Prot: 100% identical to DGAR_SALT1: Transcriptional regulatory protein DagR (dgaR) from Salmonella typhimurium (strain 14028s / SGSC 2262)

KEGG orthology group: None (inferred from 100% identity to seh:SeHA_C4103)

Predicted SEED Role

"Transcriptional regulatory protein zraR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (932 amino acids)

>GFF323 Transcriptional regulatory protein zraR (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRRIEIVLGELERLTRGLCLADLAQETAFTAEAIGFNLGLARNSVSKDLNQLWNDGLAIK
SRGRPVYFLHRQALETLLGRQLEESEREVRSVADVLPHEEHYAPDDPFTSLIGYDRSLRD
AVEKGRAAVLYPHGLHVLLTGPSGVGKTFFAELMHRFACEQASGAIPPLVYFNCAEYAHN
PELLSSHLFGHRQGAFTGANEHKTGLVEQADGGYLLLDEVHRLSYEGQEKLFSILDKGEY
RPLGVSSQPRSISVRLICATTEPVGSALLRTFQRRIQVCIDLPGIRQRSVEEQIELIVGF
LQRESRKIERTVSIDKPLLLWLLNKPLEGNIGQLKSDIQFLCAQAWASGMTEHNDTLQLD
KRLAEMSVNPTPEQRLLVDTLFEGKARLNIDARTLPALKTSLATGAEIEESDLFYSFLTR
EYVNLRNSNVPPAETLAILKNKLSSIFEYGLYSRDSVAHPPRYGDQIEERVTLLIGCVEQ
VLGFSLPENLVNPLRKHFLALIGYVQRGLIPQLYSSSLILDRCKDEYDNATLLCRKINEL
LHIQCPATEVVWLCLFLKECRHYRQRIDASPDCGVILIAHGATTATSQAQYVNRVLEREL
FSAIDMPFEQSVHDTLETLTQMIQTRQYRRLILLVDIGSLIHFGSTISKLFQIDVLLMPN
ITLTSLLEVGLDLSYETSDLPQLTALLQSKNIPCQLCTPQQENGGKVLVISCITGMGTAE
KIKKVLEESFGELMSQDTRMVILDYNEVRSLERVQQALNASERLAGIVGTFQPGLPDIPF
ISLEELFSEQGPELVLSLLTPDLSNAERRLEMERSAMRFISALTMESIINHISVLNPQRI
LKEMEGVFNHLTSSLSLKPSRQVTLRFLIHCCCMVERIVINRKPLQMALESQPNLDARAF
SVIKSAFLPIEDAYAIRLSDAEYFYIYELLYS