Protein Info for GFF3228 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Threonine dehydrogenase and related Zn-dependent dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF08240: ADH_N" amino acids 27 to 155 (129 residues), 70.4 bits, see alignment E=2.2e-23 PF00107: ADH_zinc_N" amino acids 194 to 325 (132 residues), 105.6 bits, see alignment E=2.7e-34 PF13602: ADH_zinc_N_2" amino acids 227 to 354 (128 residues), 38.2 bits, see alignment E=3.9e-13

Best Hits

Swiss-Prot: 87% identical to ADH_CUPNH: Alcohol dehydrogenase (adh) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 91% identity to pna:Pnap_3852)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>GFF3228 Threonine dehydrogenase and related Zn-dependent dehydrogenases (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAALMKAAVFVEKDRIEVVDKPIPDVGPNDALIRITTTTICGTDVHILNGEYPVAKGLTV
GHEPVGVIEKLGSAVQGYGEGQRVIAGAICPNFNSYAAQDGAPSQDGSYLVPQGLCGCHG
FKATAGWRFGNLIDGTQAEYVLVPDAQANLAPIPDGLTDEQVLMCPDIMSTGFKGAENAS
IRIGDTVVVFAQGPIGLCATAGARLLGASTIIAVDGNDHRLDIAKKMGADLTLNFKDCDV
VDEIMKATGGRGVDASIEALGTQATFESALRVLKPGGTLSSLGVYSSDLTIPLSAFAAGL
GDHRIVTALCPGGKERMRRLMNVLASGRVDLGVMVTHEYKLEHIVAAYDLFAHQRDGVLK
IAIKP