Protein Info for GFF3226 in Xanthobacter sp. DMC5

Annotation: Lipid A biosynthesis lauroyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details PF03279: Lip_A_acyltrans" amino acids 35 to 311 (277 residues), 120.6 bits, see alignment E=4e-39

Best Hits

KEGG orthology group: K02517, lipid A biosynthesis lauroyl acyltransferase [EC: 2.3.1.-] (inferred from 87% identity to xau:Xaut_1257)

MetaCyc: 47% identical to Kdo2-lipid IVA acyltransferase (Brucella abortus 2308)
RXN2B4Q-66 [EC: 2.3.1.241]

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.241

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>GFF3226 Lipid A biosynthesis lauroyltransferase (Xanthobacter sp. DMC5)
VARLPLPVRKAIHRLKLALAPAVEVLVAGYVRFSVWWLRLWPLWLSAGGMAFWAKLLGPF
FAVSKVARRNLAAAYPEKSPAEINTLVRGIWANMGRLAAEFAQQDRLWDYDPAHPDTGRI
EVKGAEIFQRLRDDGRPALFFTAHTGNWELCAIAGAAFGMPGGVLYRAPNNKRAAELIEE
MRSGTMPGLVRAGRDAGRQMARMLAEGQHLGMLIDQYWTGGPPVMFFGRPCATNPTLARL
ARQFDCPVHGMRVIRLPGARFRVEITEEIALPRDGEGKIEVVGAMQAVTSVIEGWVREYP
EQWLWLHRRWR