Protein Info for PS417_16500 in Pseudomonas simiae WCS417

Annotation: arginyl-tRNA-protein transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 154 to 170 (17 residues), see Phobius details PF04376: ATE_N" amino acids 15 to 85 (71 residues), 89.1 bits, see alignment E=1.8e-29 PF04377: ATE_C" amino acids 105 to 226 (122 residues), 143.1 bits, see alignment E=6.5e-46

Best Hits

Swiss-Prot: 98% identical to BPT_PSEFS: Aspartate/glutamate leucyltransferase (bpt) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00685, arginine-tRNA-protein transferase [EC: 2.3.2.8] (inferred from 98% identity to pfs:PFLU3803)

Predicted SEED Role

"Arginine-tRNA-protein transferase (EC 2.3.2.8)" in subsystem Protein degradation (EC 2.3.2.8)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UB85 at UniProt or InterPro

Protein Sequence (235 amino acids)

>PS417_16500 arginyl-tRNA-protein transferase (Pseudomonas simiae WCS417)
MTELARLKFYATQPHSCSYLPDEQATTLFLDPSQPMDVHVYADLSEMGFRRSGDHLYRPH
CQNCNACVPARIPVAQFLPDRNQKRILKRNADLTVMPTKPRFTEEYFDLYQRYIEERHAD
GDMFPPSRDQFSTFLVRDLPFSRFYEFRADGRLLAVAVTDLLPNGLSAVYTFYEPGEERR
SLGRFAILWQIGEALRLELEAVYLGYWIKNCKKMNYKTQYRPIELLINQRWVVLN