Protein Info for GFF3198 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Inner membrane protein YqjF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details PF07681: DoxX" amino acids 39 to 118 (80 residues), 74.8 bits, see alignment E=3.6e-25

Best Hits

Swiss-Prot: 91% identical to YQJF_ECOLI: Inner membrane protein YqjF (yqjF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to sei:SPC_3308)

Predicted SEED Role

"Inner membrane protein YqjF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>GFF3198 Inner membrane protein YqjF (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MILSSDNNDAPNRVIAHENSSSRRIGPLENKMKKLEDVGVLIARILMPVLFITAGWGKIS
GYAGTQQYMEAMGVPGFLLPLTILLEFGGGLAILLGFLTRTTALFTAGFTLLTALIFHSN
FAEGVNSLMFMKNLTIAGGFLLLALTGPGAFSLDRLLNKKW