Protein Info for PS417_16360 in Pseudomonas simiae WCS417

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 163 to 189 (27 residues), see Phobius details PF16750: HK_sensor" amino acids 49 to 158 (110 residues), 117.8 bits, see alignment E=5.9e-38 PF00672: HAMP" amino acids 185 to 238 (54 residues), 38.5 bits, see alignment 2.3e-13 PF00512: HisKA" amino acids 244 to 301 (58 residues), 45.5 bits, see alignment 1.3e-15 PF02518: HATPase_c" amino acids 349 to 454 (106 residues), 75.1 bits, see alignment E=1.2e-24

Best Hits

Swiss-Prot: 52% identical to PFES_PSEAE: Sensor protein PfeS (pfeS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 80% identity to pfl:PFL_4449)

Predicted SEED Role

"Two-component sensor histidine kinase PfeS, enterobactin" in subsystem Siderophore Enterobactin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U842 at UniProt or InterPro

Protein Sequence (456 amino acids)

>PS417_16360 histidine kinase (Pseudomonas simiae WCS417)
MTAFERPLKRLPGKHSLFWKLACLLIAFCLLMIWLSWSWGRYMEQKNAYLSDEARITLSG
YAVGAEQAWSQGGRAGVDAWLQAMGKRETTWIGVIGNDLQSLSSYPLTDKESQRLTFLRG
LDWPVSRHVKGLPWLKIPFPVDPNAGSLVIELPQRFMPGRYQLFWRVVTNGVIPGLFTLL
LCVGLYRLLIVPLNQLREQANAWRADQLNTRLSHDATSRRDELGELGRAFDHMSERLQGT
VVLQQQLLRDMSHELRTPLSRLRVACDSEQDLTQLRERLGREIDAMQRLVEDSLQLAWLD
TERAPLPQEDIQLQALWDMLRENACFESDWPASRLPCLLGPDCWVRGNLNALAQALENIL
RNAIRHSPVGGVVSLDGRREGDYWHVWLEDQGGGIDEGDLERIFAPFTRLDGSRPGDGGF
GLGLSIARNAVQRQDGSLWAENTGQGLRVHLRLRAC