Protein Info for PS417_01625 in Pseudomonas simiae WCS417

Annotation: rRNA methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF00588: SpoU_methylase" amino acids 2 to 142 (141 residues), 113.2 bits, see alignment E=5.6e-37

Best Hits

Swiss-Prot: 61% identical to TRML_AERHH: tRNA (cytidine(34)-2'-O)-methyltransferase (trmL) from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)

KEGG orthology group: K03216, RNA methyltransferase, TrmH family, group 2 [EC: 2.1.1.-] (inferred from 98% identity to pfs:PFLU0341)

MetaCyc: 59% identical to tRNA (cytidine/uridine-2'-O)-ribose methyltransferase (Escherichia coli K-12 substr. MG1655)
2.1.1.M27 [EC: 2.1.1.M27]; RXN-11860 [EC: 2.1.1.M27, 2.1.1.207]; 2.1.1.207 [EC: 2.1.1.M27, 2.1.1.207]

Predicted SEED Role

"tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207)" (EC 2.1.1.207)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.207 or 2.1.1.M27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYP5 at UniProt or InterPro

Protein Sequence (151 amino acids)

>PS417_01625 rRNA methylase (Pseudomonas simiae WCS417)
MFHVILFQPEIPPNTGNVIRLCANSGCHLHLIEPLGFDMDDKRLRRAGLDYHEYATLKRH
ADLASCLESLGHPRLFAFTTKGSQPFHDVSFAEGDAFLFGPESRGLPAEVLDALPDGHRL
RLPMREGCRSLNLSNTVAVAVYEGWRQLGFK