Protein Info for GFF319 in Sphingobium sp. HT1-2

Annotation: Intracellular septation protein IspA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 146 to 161 (16 residues), see Phobius details amino acids 170 to 194 (25 residues), see Phobius details TIGR00997: intracellular septation protein A" amino acids 16 to 198 (183 residues), 175.3 bits, see alignment E=6.8e-56 PF04279: IspA" amino acids 16 to 197 (182 residues), 181.6 bits, see alignment E=8.4e-58

Best Hits

Swiss-Prot: 43% identical to YCIB_OLICO: Probable intracellular septation protein A (OCAR_4259) from Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)

KEGG orthology group: K06190, intracellular septation protein (inferred from 88% identity to sch:Sphch_1645)

Predicted SEED Role

"Probable intracellular septation protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>GFF319 Intracellular septation protein IspA (Sphingobium sp. HT1-2)
MPADAKKPAHGGSLSLALDFGPLLVFFLSYKGAGWFWGAGNPITAMSFGTAAFMAAIVIA
VIISKVKLGRVSPMLWLSALLILFFGGLTIYFHDQRFIQLKPTIIYAFFALMLFAGLLRG
KPLLKYLLQAAYDGLTEEGWRKLSRNWALFFVAMAVANELMRRSMSFDTWLAVKVWGVTI
VSVVFAGANIPMLLRHGLTLDDGLDSDEVGETTPPQG