Protein Info for GFF3186 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 PF26049: RLMG_N" amino acids 1 to 179 (179 residues), 246.6 bits, see alignment E=5.3e-77 PF05175: MTS" amino acids 199 to 370 (172 residues), 189.8 bits, see alignment E=1e-59 PF06325: PrmA" amino acids 230 to 305 (76 residues), 23.2 bits, see alignment E=1.6e-08 PF03602: Cons_hypoth95" amino acids 230 to 319 (90 residues), 24.7 bits, see alignment E=5.9e-09 PF13847: Methyltransf_31" amino acids 231 to 344 (114 residues), 34.3 bits, see alignment E=7e-12 PF13649: Methyltransf_25" amino acids 232 to 334 (103 residues), 34.8 bits, see alignment E=7.8e-12 PF08242: Methyltransf_12" amino acids 233 to 336 (104 residues), 38.3 bits, see alignment E=6.5e-13

Best Hits

Swiss-Prot: 100% identical to RLMG_SALPA: Ribosomal RNA large subunit methyltransferase G (rlmG) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K11391, ribosomal RNA large subunit methyltransferase G [EC: 2.1.1.174] (inferred from 100% identity to sei:SPC_3296)

MetaCyc: 91% identical to 23S rRNA m2G1835 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11635 [EC: 2.1.1.174]

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.174

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>GFF3186 23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSHVDDGFRSLTLKRFPQTDDVNPLLAWEAADEYLLQQLDETEIRGPVLILNDTFGALSC
ALAEHSPYSIGDSYLSELGTRENLRHNGIAESSVTFLDSTADYPQAPGVVLIKVPKTLAL
LEQQLRALRKVVTAQTRIIAGAKARDIHTSTLELFEKVLGPTTTTLAWKKARLINCTFSH
PQLADAPQTLSWKLEDTGWTIHNHANVFSRTGLDIGARFFMQHLPENLDGEIVDLGCGNG
VIGLSLLAKNPQANVVFVDESPMAVDSSRLNVETNLPEAFERCEFMINNALSGVEPFRFN
AVFCNPPFHQKHALTDNIAWEMFHHARRCLKINGELYIVANRHLDYFHKLKKIFGNCATI
ATNNKFVILKAVKQGRRR