Protein Info for PS417_16310 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 194 to 219 (26 residues), see Phobius details PF01027: Bax1-I" amino acids 21 to 216 (196 residues), 153.4 bits, see alignment E=3.8e-49

Best Hits

Swiss-Prot: 81% identical to Y2604_PSEAE: Uncharacterized protein PA2604 (PA2604) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06890, (no description) (inferred from 100% identity to pfs:PFLU3767)

Predicted SEED Role

"Putative TEGT family carrier/transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U832 at UniProt or InterPro

Protein Sequence (223 amino acids)

>PS417_16310 membrane protein (Pseudomonas simiae WCS417)
MREQNYAVNGNAQAEQLEVSRVLRNTYGLLALTLAFSGVMAFVAQQMRVGYPNIFVVLIG
FYGLFFLTNKLRDSAWGLVSAFALTGFMGFILGPILNRYLGMAGGAEVVSSAFAMTALVF
GGLSAYVLITRKDMSFLGGFITAGFFVLLAAVVAGMFFQISGLQLAISAGFVLFSSVCIL
FQTSAIIHGGERNYIMATISLYVSIYNLFISLLQIFGIMSRDD