Protein Info for GFF3182 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Aerotaxis sensor receptor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 163 to 181 (19 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 20 to 114 (95 residues), 37.2 bits, see alignment E=1.5e-13 PF13426: PAS_9" amino acids 21 to 110 (90 residues), 32.3 bits, see alignment E=2e-11 PF00989: PAS" amino acids 21 to 112 (92 residues), 30.4 bits, see alignment E=6.9e-11 PF08447: PAS_3" amino acids 31 to 112 (82 residues), 56.3 bits, see alignment E=6.4e-19 PF00015: MCPsignal" amino acids 319 to 474 (156 residues), 161.1 bits, see alignment E=5e-51

Best Hits

Swiss-Prot: 84% identical to AER_ECOLI: Aerotaxis receptor (aer) from Escherichia coli (strain K12)

KEGG orthology group: K03776, aerotaxis receptor (inferred from 99% identity to spq:SPAB_04014)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (506 amino acids)

>GFF3182 Aerotaxis sensor receptor protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSSHPYVSQLNTPLDDDTTLMSTTDLESYITHANDTFVQVSGYQLNELLAQPHNLVRHPD
MPKAAFADMWYTLKQGEPWSGIVKNRRKNGDHYWVRANAVPMIREGRVTGYMSIRTRATD
DEVAAVEPLYQALNEGRCSKRIHKGLVVRQGLLGKLPAMPVRWRVRSIMGLMAVMLALAL
FGTDASWQALLLGALAMLAGTALLEWQIVRPIENVATQALKVATGERNSVQHLNRSDELG
LTLRAVGQLGLMCRWLINDVSSQVSSVRNGSERLAKGNNDLNEHTRQTVENVQETVTTMN
QMAESVKLNSETASAADKLSMAASSAATQGGEAMDTVIKTMDDIAHSTQRIGTITTLIND
IAFQTNILALNAAVEAARAGEQGKGFAVVAGEVRHLASRSANAANDIRKLIDASATKVQS
GSEQVHAAGRTMDDIVAQVQNVTLLIARISQSTQEQTDGLSSLTRAVDELNRITQKNAAL
VEESAQVSAMVKHRASRLEDAVTVLH