Protein Info for GFF3175 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details amino acids 331 to 351 (21 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details amino acids 400 to 422 (23 residues), see Phobius details PF00083: Sugar_tr" amino acids 13 to 221 (209 residues), 88.9 bits, see alignment E=3.6e-29 PF07690: MFS_1" amino acids 19 to 226 (208 residues), 62.7 bits, see alignment E=3.1e-21 amino acids 252 to 424 (173 residues), 50.7 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_3837)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>GFF3175 Uncharacterized MFS-type transporter (Variovorax sp. SCN45)
MSASDEKAIRRVVVSALVGATIEWYDFFLYGVVAGIVFNKLYFPGSDPVVSTLLAYTTFA
VGFVTRPLGGVIFGHFGDKIGRKSMLIITLMIMGVATFLIGLVPTYAQIGIAAPLLLLLL
RVAQGIGLGGEWGGAVLMAYEYAPKEKRGFYASLPQIGLAIGLCLASGVVALLSSLLTDE
QFLSWGWRIAFLISGAMVMVGMYIRLHVKETPEFAAVKARNAELRIPFMDMIRRYPGNVL
KGMGARYIDGVFFNIFGVFSINYLTSTIKISRTEALLGVMASAVVMCFAIPFFGRMSDRL
GRPQVYMWGSLITAVSAFPGFWLMTHSGGNVLLIWLSIIIPFGILYASVYGPEAALFCDL
FDAKVRYTGISFVYQFSGIFASGITPIIATALLKSGGGEPWQICLYVLFAGVVSAVCAWM
IGRSASPADAPVAVASR