Protein Info for GFF3173 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 614 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 177 to 198 (22 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 242 to 267 (26 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details amino acids 367 to 384 (18 residues), see Phobius details PF07730: HisKA_3" amino acids 431 to 477 (47 residues), 26 bits, see alignment 5.7e-10

Best Hits

KEGG orthology group: None (inferred from 62% identity to rfr:Rfer_3372)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (614 amino acids)

>GFF3173 Sensor kinase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MGWRWLLCLGLALGLSGPLHADEQEAPHRPALELREAQATVVVDGHTERRQLTLPYHWDR
HHPGRAGRATFDLTFTLPEVPQEPWSIYLPRLGNAYEVWLNGLLVQHEGDMLQANGADHG
QVPRMAPLPAGLLQLNNTLQVRVRADVGRRGGLSTVWIGPREAVGAKYAEAYRWRVTGSM
VVVGFSLLVGLISLSLWVTQPDLSNTVRQQRDPLYLYAGLAELFWTVRVGDALIENPVLA
WPWWGVVPVVALAVWSWSMGLFCLHVAGWESRPAGRLMANWLMALMLASGPMAVWALALG
QPLALTAWYAALGLSFLPFGAAFLDRALRGASVPHRVVALAVLLNMAVGFRDLYVFRINP
TYADSSLMRYSSVFFGLGLAYIVIERFRRVSAQVRDLLNTLAARVSEKERELAETYRRVE
QLAREQERTAERTRILRDMHDGVGAHISSAIRQLESGRSSQQELLQTLRDSLDQLKLSID
AMNLPPGDVTALLANLRYRLEPRLQASDIALRWAVELIEPLQRLDAGAMRQLQFMVFEAL
SNVLQHAQATELCIEAVAAEQGVRLRIVDNGRGFDATAPWRKGLLAMRERARAIGAVLSL
QSAPGRTVVEIQLS