Protein Info for GFF3173 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 71 to 100 (30 residues), see Phobius details amino acids 108 to 157 (50 residues), see Phobius details amino acids 162 to 177 (16 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 1 to 195 (195 residues), 275.6 bits, see alignment E=1.2e-86 PF02660: G3P_acyltransf" amino acids 11 to 184 (174 residues), 184.2 bits, see alignment E=1.1e-58

Best Hits

Swiss-Prot: 100% identical to PLSY_SALPK: Glycerol-3-phosphate acyltransferase (plsY) from Salmonella paratyphi A (strain AKU_12601)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 98% identity to ses:SARI_04422)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>GFF3173 Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSAIAPGMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGATNVLRIGGKGAAVAVLI
FDILKGMLPVWGAYALGVTPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW
DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN
IQRLWRRQETKIWTKLKKKRQKD