Protein Info for GFF3171 in Sphingobium sp. HT1-2

Annotation: '23S rRNA (uridine(2552)-2'-O)-methyltransferase (EC 2.1.1.166)' transl_table=11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF01728: FtsJ" amino acids 42 to 216 (175 residues), 184.6 bits, see alignment E=8.9e-59

Best Hits

Swiss-Prot: 76% identical to RLME_NOVAD: Ribosomal RNA large subunit methyltransferase E (rlmE) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K02427, ribosomal RNA large subunit methyltransferase E [EC: 2.1.1.-] (inferred from 89% identity to sch:Sphch_1838)

Predicted SEED Role

"Heat shock protein FtsJ/RrmJ @ Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>GFF3171 '23S rRNA (uridine(2552)-2'-O)-methyltransferase (EC 2.1.1.166)' transl_table=11 (Sphingobium sp. HT1-2)
VRGSGAGKVRVKSAKGRTAQSVRWLERHLNDPYVHKAKQEGWRSRAAFKLIELDEKFHFV
KGSRAVVDLGVAPGGWAQVIRKMAPKAAVVGIDLLPVDPIPGVTLFEMDFMDDKAPDLLR
EALGQEPDLVISDMAANTVGHAQTDHLRTMGLVEAAADFAVQNLRKGGTFVAKVFAGGTD
AELLAVLKKHFTTIKHAKPPASRKGSVEWYVVAQGFKGRPDAQE