Protein Info for GFF3171 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Undecaprenyl-diphosphatase (EC 3.6.1.27)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 50 to 69 (20 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 157 to 172 (16 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details TIGR00753: undecaprenyl-diphosphatase UppP" amino acids 10 to 265 (256 residues), 361.1 bits, see alignment E=1.9e-112 PF02673: BacA" amino acids 10 to 266 (257 residues), 294.4 bits, see alignment E=4.5e-92

Best Hits

Swiss-Prot: 100% identical to UPPP_SALTI: Undecaprenyl-diphosphatase (uppP) from Salmonella typhi

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 97% identity to eco:b3057)

MetaCyc: 97% identical to undecaprenyl pyrophosphate phosphatase (Escherichia coli K-12 substr. MG1655)
RXN-11776 [EC: 3.6.1.68]; Undecaprenyl-diphosphatase. [EC: 3.6.1.68, 3.6.1.27]

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.27 or 3.6.1.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>GFF3171 Undecaprenyl-diphosphatase (EC 3.6.1.27) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV
VVMFWRRLFGLIGIHFGRPLQREGESKGRLTLIHILLGMIPAVVLGLVFHDTIKSLFNPI
NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS
GGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSFLTAADIPMFAVGFVTAFVVALI
AIKTFLQLIKRISFIPFAIYRFVVAAAVYVVFF