Protein Info for GFF3169 in Variovorax sp. SCN45

Annotation: Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 PF00501: AMP-binding" amino acids 13 to 368 (356 residues), 292.7 bits, see alignment E=3.8e-91 PF13193: AMP-binding_C" amino acids 419 to 494 (76 residues), 64.3 bits, see alignment E=1.7e-21

Best Hits

Swiss-Prot: 60% identical to SAUT_CUPNH: Probable sulfoacetate--CoA ligase (sauT) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 90% identity to vpe:Varpa_4410)

MetaCyc: 60% identical to sulfoacetate-CoA ligase (AMP-forming) (Cupriavidus necator H16)
6.2.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (506 amino acids)

>GFF3169 Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3) (Variovorax sp. SCN45)
MTAPATTVHALIEQQAQRQPHAVYARATETGQHLTYGELARGCRRVAAVLHGAGARPGDT
ISVVMPNGLQTLRLLLGAMHGGLRVNPVNLLSQPEQMRYVLAHADCRVVCVAPEWEARVR
EIVQAFDRPVTVLVVDPEAEVLPGETEAPAVAVPPPLPDAVALLMYTSGTTGMPKGVMLS
QRNLAANAYAISAEHGLRSSDRVLAVLPLYHINAFTVTMLAPLAHGGSLAMPPKFSAGRF
WEQATQTQCSWINLVPTMISYLLEGPKPPLAQTLAIRFCRSASAALPPEHLRAFEQKFGI
GIVETMGLTETAAPSFSNPMDPAARKLGSVGRASGCMAGVVDAKLSAVPDGVTGELVIRG
PNVMLGYYKNEEATRASFTPDGWLRTGDLGHRDEDGFFFVTGRIKELIIKGGENIAPREI
DEALMRHPAVREAAAVGVPDRHYGQEIGVCIVLREGCACTEDELRAFGAEALGRYKTPGH
YRFVNDLPRGPSGKVQRLKLLPLFQA