Protein Info for GFF3168 in Sphingobium sp. HT1-2

Annotation: Peptidase, M23/M37 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 44 to 66 (23 residues), see Phobius details PF19353: DUF5930" amino acids 11 to 109 (99 residues), 29.8 bits, see alignment E=3.4e-11 PF01551: Peptidase_M23" amino acids 274 to 368 (95 residues), 119.6 bits, see alignment E=5.6e-39

Best Hits

KEGG orthology group: None (inferred from 75% identity to sch:Sphch_1835)

Predicted SEED Role

"Peptidase M23/M37"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>GFF3168 Peptidase, M23/M37 family (Sphingobium sp. HT1-2)
LSQRKKKGVATLWARLSALCPEREIFLRSGGQVKFIRISKRAQLLALGILSTGLVGWGAV
TVSMLASSAAVAHDRAMLDAKGAAVASKARKVDGYRKSVNDLAHDLEARQDFIDDLYKTH
FGEPGDAAANAPVGKADAATDKAGQGKLNAKISMAPEAAPLMQVDARQRRFAALLTSAVE
ARAQKAAAAIRSFGLNPDALARNAARAQGGPFVPWHGDEDAMPAELEKLATALSRMEFLE
TSLLRIPSGQPTGTPMLSSSYGYRRDPFNGHAAFHAGLDFPGRYGQPILAAAPGKVSYVG
QRSGYGNVVEVTHGNGIMTRYAHLSGFNARVGQQVARGDQIARMGSTGRSTGTHLHFEVR
VNGDPINPRRFLEARKDVLQVQQIATARLADVGNRG