Protein Info for GFF3166 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: DNA primase (EC 2.7.7.-), phage-associated

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF08273: Prim_Zn_Ribbon" amino acids 38 to 73 (36 residues), 28.9 bits, see alignment 1.1e-10 PF13362: Toprim_3" amino acids 228 to 325 (98 residues), 58.7 bits, see alignment E=6.6e-20

Best Hits

KEGG orthology group: K06919, putative DNA primase/helicase (inferred from 85% identity to ajs:Ajs_1556)

Predicted SEED Role

"DNA primase (EC 2.7.7.-), phage-associated" in subsystem DNA-replication (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>GFF3166 DNA primase (EC 2.7.7.-), phage-associated (Hydrogenophaga sp. GW460-11-11-14-LB1)
MQNAEYAARVDAVKQRAHGRWTEILGAMGLDERLLKRKPMPCPVCKDGVDRFQYTDKFGE
GNYHCRKCGPGGGFKLLQACKAMDFHAALCAVEKVLGMLPPAQPPDDATPERMKKLVQRI
WNEARAVTLGDVVDRYLRGRGLALSSYPGSLRFHPALGYYQKEGVAKARKVAEYPAMLAS
VQDAQGAVTLHRTYLQAGRKLDAPDAKKVLSGGFSGAAVRLAEPTDELAVCEGIETGIAV
FLATRKPVWCALSAGNLEKLWVPDTVRSVCVYGDNDADGDFTGQASAYAAARRLKREEVQ
GGPRAIRVFLPRQAGTDWADVWRQRQEAVLLRAA