Protein Info for PS417_16175 in Pseudomonas simiae WCS417

Annotation: porin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 35 to 57 (23 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details PF00230: MIP" amino acids 3 to 219 (217 residues), 158.6 bits, see alignment E=1.1e-50 TIGR00861: MIP family channel proteins" amino acids 7 to 219 (213 residues), 182.5 bits, see alignment E=5.3e-58

Best Hits

Swiss-Prot: 67% identical to AQPZ2_AGRFC: Aquaporin Z 2 (aqpZ2) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K06188, aquaporin Z (inferred from 89% identity to pfs:PFLU3733)

MetaCyc: 64% identical to water channel AqpZ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-145

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4W8 at UniProt or InterPro

Protein Sequence (251 amino acids)

>PS417_16175 porin (Pseudomonas simiae WCS417)
MQKRLTAEFIGTFWLTFGGCGSAILAAAFPELGIGFVGVSLAFGLTVLTMAYAVGGISGG
HFNPAVTLGLWAGRRVAAGEVLPYIAAQVAGAIGASAALYLIANGQPDFAIGGFAANGYG
PLSPGLFDMKAALLAECIATFFFLFIIMRVTSSGAVPGFAPIAIGLALTLIHLVLIPVTN
TSVNPARSTGPALFAGGEYLAQLWLFWLAPMVGGVMGALAARSLGERDKSAGPPQPAPPC
DQRRVGRSTPC