Protein Info for GFF3160 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: IncF plasmid conjugative transfer protein TraD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 638 signal peptide" amino acids 1 to 48 (48 residues), see Phobius details TIGR03743: conjugative coupling factor TraD, SXT/TOL subfamily" amino acids 6 to 620 (615 residues), 673.7 bits, see alignment E=1.4e-206 PF10412: TrwB_AAD_bind" amino acids 455 to 608 (154 residues), 38.9 bits, see alignment E=5.1e-14 PF12696: TraG-D_C" amino acids 474 to 599 (126 residues), 47 bits, see alignment E=2.4e-16

Best Hits

KEGG orthology group: K12071, conjugal transfer pilus assembly protein TraD (inferred from 91% identity to ajs:Ajs_1549)

Predicted SEED Role

"IncF plasmid conjugative transfer protein TraD" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (638 amino acids)

>GFF3160 IncF plasmid conjugative transfer protein TraD (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLVRRYEMPWRHAFEAHAGLVWLAATLYFAGVAATGRLPAMPALVLAATCLLMGLRRLAQ
AVRVLRLRGSLGGRRIQVLGTDQLARLCTDPSQVFLGFGFEWRPVHAQRLYELSKVDYRE
FTVPRWLQLVLGQGDAAQPDAEIGLPYIHGVEPREHPLHRPLQNFEGGTLLVGTTQSGKG
VALANLITQAVRRGDVVIVIDPKNSRRLKRVVERACEDYREADTFMEFHPAFPDRGVRLD
FTFNWQKPTEIASRIQSIMPPDTAGAFSAFGWDAVNVVVQGLVALEERPNLIKLTKYIEG
GIEPVLEASLRRFYEQLLGSAWREQPEMRKLLHDAHRGNMRRPSEAASADLMAFVAYYEH
LVAQNQRDKVLDAQVRVFRHNREHYQKITANLLPILSMLTSGDLGRSLSPDPFDADDMRP
IMNFEKIERGGHVLYMCLDALPDPSVASAIGALALADQAARAGMRYNLGTYRRIALFVDE
VSNVINQPLIEILNKGAEGGIFATCAMQTLADLARRLGSEDAARMALGNLNNLIALRTKD
RPTQDFVVETFGKTAIHTVRVGLSHGADAHLGDFSSSYSTQLTESFEEVVPADILGKLPN
LQYFASVSGGRIVKGRFPIIDPDADGRPEGSRSEERRA