Protein Info for GFF316 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative DNA-binding protein in cluster with Type I restriction-modification system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF01381: HTH_3" amino acids 52 to 95 (44 residues), 35 bits, see alignment E=6e-13

Best Hits

KEGG orthology group: K07726, putative transcriptional regulator (inferred from 100% identity to stm:STM3778)

Predicted SEED Role

"Putative DNA-binding protein in cluster with Type I restriction-modification system" in subsystem Restriction-Modification System

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>GFF316 Putative DNA-binding protein in cluster with Type I restriction-modification system (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSAKTKFKSPAFEPIHSAASGLFSVDAIPQETMRSFDTACLSSIKDLQPLEIKALREKLN
VSQPVFARYLNTSVSTVQKWESGAKRPSGMSLKLLNVVQKHGLKVLV