Protein Info for GFF3159 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Inner membrane thiol:disulfide oxidoreductase, DsbB-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 27 to 53 (27 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details PF02600: DsbB" amino acids 25 to 212 (188 residues), 86 bits, see alignment E=1.8e-28

Best Hits

Swiss-Prot: 100% identical to DSBI_SALTY: Protein-disulfide oxidoreductase DsbI (dsbI) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03611, disulfide bond formation protein DsbB (inferred from 100% identity to sei:SPC_3268)

Predicted SEED Role

"Inner membrane thiol:disulfide oxidoreductase, DsbB-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>GFF3159 Inner membrane thiol:disulfide oxidoreductase, DsbB-like (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDFIKGLWRDLRARPVDTLVRWQEQRFLWLLMAIAMGGLIILAHSFFQIYLYMAPCEQCV
YIRYAMFVMVIGGVIAAINPKNIVLKLIGCIAAFYGSIMGIKFSIKLNGIHHAVHNADPD
SLFGVQGCSTDPTFPFNLPLAEWAPEWFKPTGDCGYDAPIVPDGVTLSSVQQWFVDLYQQ
SEGWYLLPPWHFMNMAQACMLAFGLCLILLLVMSGAWALKLARGK