Protein Info for PS417_16145 in Pseudomonas simiae WCS417

Annotation: sulfonate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 84 to 108 (25 residues), see Phobius details amino acids 134 to 159 (26 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 238 to 266 (29 residues), see Phobius details amino acids 291 to 315 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 146 to 318 (173 residues), 71 bits, see alignment E=5.6e-24

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 94% identity to pfs:PFLU3718)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U809 at UniProt or InterPro

Protein Sequence (329 amino acids)

>PS417_16145 sulfonate ABC transporter permease (Pseudomonas simiae WCS417)
MSSADATTLNPSLAFKVRWQGVAVVGAWLAVALLISFWPNATRNWPMTQGLANLCVGIAG
LYVVLSLLGRTVSKLGQRLRNAGPWLIALPVLLGGWELLTAKLALLPVPFFAPPQALLAV
YIEDYARLADSLLHSALLLGSGVALGTITGFIAGVAIGWSTRIGYWLHPVLRILGPVPST
ALLPLCFFLFPSSWSASVFLIALATWFPVTVLTWSGVASVDKAYYDVARTLGAKQGFLIF
KVAIPAALPHVFVGLFMGLGASFSTLVVAEMMGVKSGIGWYLQWAQGWAAYANMYAALLI
MALACSGLITGLFLVRDRLLAWQKGSMKW