Protein Info for GFF3146 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Thiol:disulfide involved in conjugative transfer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details PF10411: DsbC_N" amino acids 54 to 106 (53 residues), 48.6 bits, see alignment 4.2e-17 PF13098: Thioredoxin_2" amino acids 151 to 270 (120 residues), 82.1 bits, see alignment E=3.4e-27

Best Hits

KEGG orthology group: K03981, thiol:disulfide interchange protein DsbC [EC: 5.3.4.1] (inferred from 82% identity to del:DelCs14_1693)

Predicted SEED Role

"Thiol:disulfide involved in conjugative transfer"

Isozymes

Compare fitness of predicted isozymes for: 5.3.4.1

Use Curated BLAST to search for 5.3.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>GFF3146 Thiol:disulfide involved in conjugative transfer (Hydrogenophaga sp. GW460-11-11-14-LB1)
MATIESVRASRRLVDPTTRNLAQRRALRLALCGALLAVASMGRAATPDETRLLAALRTAH
PGTQFTEVSRTDVEGLYEVWMSGNVAYVAATNPRFFIFGRLFDTQSMRDITGPKIAQRNA
DQGGQLQSESVSPAPVSIDQLPLADAIKTVRGNGQRKLAVFSDPNCIYCKQLEPELAGID
NVTVYTFLVPFQGEARPIAIWCAADRERAWRQWMLQADASPLQPNPSCEHPVMRNLDLAR
RLGVQGTPTLFWADGTRTDGYVGRSVLEAKLTEAAKIAASKPSAAGRKP