Protein Info for GFF3145 in Xanthobacter sp. DMC5

Annotation: Long-chain-fatty-acid--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 206 to 228 (23 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details PF00501: AMP-binding" amino acids 15 to 362 (348 residues), 252.7 bits, see alignment E=5.4e-79 PF13193: AMP-binding_C" amino acids 412 to 487 (76 residues), 61.9 bits, see alignment E=8.9e-21

Best Hits

KEGG orthology group: None (inferred from 70% identity to mrd:Mrad2831_5819)

Predicted SEED Role

"Benzoate-CoA ligase (EC 6.2.1.25)" in subsystem Benzoate transport and degradation cluster (EC 6.2.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>GFF3145 Long-chain-fatty-acid--CoA ligase (Xanthobacter sp. DMC5)
MSLPANLGDFVCRTNAPDHPLLIGLDFDGGTTVLTRAAFDALADAVARGLLRQGLVRGDR
IAILAANRPDYVAVVMGAMRAGIVPVPVNFKFPAATIADVIADCGARLVIYDGERRALLP
ATPPEGIAFVDFDGTGPGTLAGLLDPGPFEPVVPAPDEPALSLYTSGSTGRPKGVLLSHA
AHRWVADTRRTETDLSRERMLIAAPLYHMNALALALLACASGSTAVVLPQFRAVPYIEAI
ASHGCTFLTAVPPMIAMMLREKAALAQADLSGVRMLRMGSAPVTDSLAQQIRQLLPNAAI
INAYGTTEGGPIVFSGHPDGRPVPMGSVGYPHPQVAVRLVGPEAPETGELEMKSPAVMLG
YHNRPDVRSPLTADGFYRTGDVFRRDADGFYYFLGRTDDMFVCGGENIFPGEVEAVLDRH
PQVLQSCVVPVPDDIKGEKPVAFVVRRAGADISEEALKQFMLANAPAYQHPRRVWFLDQM
PLASTNKIDRSALKRRAVAELSAVGTPA