Protein Info for GFF3145 in Pseudomonas sp. DMC3

Annotation: Actin cross-linking toxin VgrG1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 671 TIGR03361: type VI secretion system Vgr family protein" amino acids 10 to 519 (510 residues), 631.7 bits, see alignment E=9e-194 TIGR01646: Rhs element Vgr protein" amino acids 22 to 502 (481 residues), 416.2 bits, see alignment E=2.1e-128 PF05954: Phage_GPD" amino acids 29 to 323 (295 residues), 275.6 bits, see alignment E=7.9e-86 PF04717: Phage_base_V" amino acids 384 to 450 (67 residues), 45.5 bits, see alignment E=1.2e-15 PF22178: Gp5_trimer_C" amino acids 468 to 568 (101 residues), 86.9 bits, see alignment E=1.6e-28

Best Hits

KEGG orthology group: None (inferred from 88% identity to pfo:Pfl01_0454)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (671 amino acids)

>GFF3145 Actin cross-linking toxin VgrG1 (Pseudomonas sp. DMC3)
MFAPANQPRFTLTLEGARHDLKVLEFTGREAISQPFRFELELVSERPDLDLESLLHCQAF
LSFDAQGCGIHGQIYQVGQGDSGKRLTRYHLSLVPRLTYLGHRINQRIFQHQSVPQIIKQ
ILKDHSILRDAFEFRLGSEYPEREYCVQYAESDLAFIQRLCAEVGIHYHFQHSPEGHLLV
FGDDQTVFPKLPAPTLYLPGSGMSAGAPAIQRFNVRVETRTSVVTRRDYNFEKPRLSLES
RSDGEQRPVLEDYLFPGQFSDRETGKQLTRRALERHVADYRQAEGSSDESSLVCGHFLQL
TEHPRSDWNDLWLLTCVEHRGRQPQVLEESVTSDGESFQGYRNTFVATPWDVVFRPALCP
EKPRMSGYQPAVVTGPKDLEIHCDEYGRVKVQLAWDRDGELNEHSSCWLRVATGWAHDHY
GSVLIPRVGMEVLVGFIDGDADKPLVMGCLPNAATPVPLDLPADKTRSIFRSQSSPGGGG
YNELRIEDKKGAEEIYLRAQRNWTQHVLNDQQLQVDNQRSVVVTGTARHELKADEQRITH
GQRQTEVRQDDHLSVLGDRQVRVNSQATSASAQIHISAGQQVVIDGGASATIQAGGQWIN
IGPGGIFSSVPIVVGGSPMAATSAAPLVPGLPEQLVAAPAAILTAAQIMSLKGDAPFCEE
CERCKDGVCAA