Protein Info for GFF3142 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Conjugative signal peptidase TrhF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 43 to 62 (20 residues), see Phobius details TIGR02771: conjugative transfer signal peptidase TraF" amino acids 45 to 203 (159 residues), 128.8 bits, see alignment E=1.6e-41 PF10502: Peptidase_S26" amino acids 73 to 200 (128 residues), 71.7 bits, see alignment E=3.6e-24 TIGR02227: signal peptidase I" amino acids 85 to 200 (116 residues), 48 bits, see alignment E=1.3e-16

Best Hits

KEGG orthology group: None (inferred from 73% identity to del:DelCs14_1689)

Predicted SEED Role

"Conjugative signal peptidase TrhF" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>GFF3142 Conjugative signal peptidase TrhF (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTLESASLAPTLPEVPTPSVRPVWWSRRRRDLQELLRHMRRRWYLYVPVFAIWGFAYARL
FIDPTPRVPVLFNWTPSLPYRMALMQYGHAALQRGDLIVFAFAGEAQEHYRGLRGQPFFK
LVRGLPGDVVTVQGRLVYVNGEPVGSAKTHGHDRHPLRPIEATVIPAGHYYVQGTSPDSF
DSRYHASGLVRADQVLGVVVPLF