Protein Info for GFF3139 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Sensory histidine kinase QseC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details PF00512: HisKA" amino acids 237 to 301 (65 residues), 45.5 bits, see alignment E=9.9e-16 PF02518: HATPase_c" amino acids 349 to 446 (98 residues), 79.4 bits, see alignment E=4.2e-26

Best Hits

Swiss-Prot: 100% identical to QSEC_SALTY: Sensor protein QseC (qseC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07645, two-component system, OmpR family, sensor histidine kinase QseC [EC: 2.7.13.3] (inferred from 100% identity to see:SNSL254_A3434)

Predicted SEED Role

"Sensory histidine kinase QseC" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>GFF3139 Sensory histidine kinase QseC (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKLTQRLSLRVRLTLIFLILVSITWAISSFVAWRKTTDNVDELFDTQLMLFARRLSTLDL
NEINAPQRMAHTPKKLKHGHIDDDALAFAIFSADGKMLLHDGDNGQDIPYRYRREGFDNG
YLKDDNDLWRFLWLNSADGKYRIVVGQEWDYREDMALAIVAAQLTPWLIALPFMLLILLL
LLHRELRPLKKLAQALRFRSPESETPLDAKGVPSEVRPLVEALNQLFSRIHSMMVRERRF
TSDAAHELRSPLAALKVQTEVAQLSGDDPLSRDKALTQLHAGIDRATRLVDQLLTLSRLD
SLNNLQDVAEISLEELLQSAVMDIYHPAQQANIDVRLQLNAHDVIRTGQPLLLSLLVRNL
LDNAIRYSPQGSVVDVTLHARSFTVRDNGPGVAPEILTHIGERFYRPPGQSVTGSGLGLS
IVRRIATLHGMTVSFGNAAEGGFEAVVSW